php-resource



Zurück   PHP-Scripte PHP-Tutorials PHP-Jobs und vieles mehr > Entwicklung > ASP, PERL, CGI, C und alles andere
 

Login

 
eingeloggt bleiben
star Jetzt registrieren   star Passwort vergessen
 

 

 


ASP, PERL, CGI, C und alles andere Wolle ma net so sein. Obwohl Perl, ASP, C und TCL zu den minderwertigen Internet-Skriptsprachen zählen, dürfen ab sofort hierzu auch Fragen gestellt werden. ;)

Antwort
 
LinkBack Themen-Optionen Thema bewerten
  #1 (permalink)  
Alt 25-10-2002, 12:20
Goaliath
 Newbie
Links : Onlinestatus : Goaliath ist offline
Registriert seit: Oct 2002
Beiträge: 2
Goaliath ist zur Zeit noch ein unbeschriebenes Blatt
Standard Variablen an Flash weitergeben

Hallo zusammen,

ich bin wirklich verzweifelt. Ich versuche seit ca. einer Woche einen Newsletter in eine flash basierte Website einzubauen. Ich verwende hierfür ein kostenloses Script von http://www.coderworld.de (diekter Link: http://www.coder-world.de/cgi-bin/cg...agewebdesignnl).

Dieses Script ist meiner Meinung nach ausgesprochen gut. Es funktioniert im html-Modus tadellos. Mein Problem besteht nun darin, die Variabeln an Flash weiterzugeben. D.h. in Flash funktionirt soweit alles. Jedoch die newsletter.cgi eben nicht.

z.B. drückt man in flash "subscribe" oder "unsubscribe" so geschieht nichts. Wie muss ich die newsletter.cgi modifizieren?

Auch die möglichen Fehlermeldung wie etwa, wenn die E-Mail-Adresse fehlerhaft ist, so scheint die Aufforderung " print "message=4"; " nichts zu bewirken.

Hat jemand vielleicht einen Tipp oder Ratschlag für mich.
Vielen Dank im voraus.

Gruß,
Goaliath
Mit Zitat antworten
freelancermap.de - IT Projektvermittlung für Selbständige und Freiberufler
  #2 (permalink)  
Alt 25-10-2002, 13:56
tobias_k
 Banned
Links : Onlinestatus : tobias_k ist offline
Registriert seit: Aug 2002
Ort: München
Beiträge: 717
tobias_k ist zur Zeit noch ein unbeschriebenes Blatt
Arrow hmmm....

.... warum machst du das nicht mit php und mysql. is einfacher.

zu perl:
File: cfg.pl
Code:
$mailprog="/usr/lib/sendmail -t";
#the system path to your mail program

$listdata="list.txt";
#the file name of the data file. You need to create this file and upload it to your server. Then chmod it to 777.

$main_page="http://www.deine-seite.com/maillist/";
#main page url. 

$yourmail="deine\@dings.com";
#your email. don't forget the back slash - \ 

$alert="n";
#send an alert mail to you if someone enters a wrong password

$header="y";
#Set this variable to n if you want to turn the header text off 
#It is the header for the email message, not the html pages

$footer="y";
#set this variable to n if you want to turn the footer text off
#It is the footer for the email message, not the html pages

#end of modification
1;
Datei: news.pl
Code:
#!/usr/bin/perl

require "cfg.pl";

read(STDIN, $buffer, $ENV{'CONTENT_LENGTH'});
@pairs = split(/&/, $buffer);
foreach $pair (@pairs) {
($name, $value) = split(/=/, $pair);
$value =~ tr/+/ /;
$value =~ s/%([a-fA-F0-9][a-fA-F0-9])/pack("C", hex($1))/eg;
$value =~ s/\n/ /g;
$form{$name} = $value;
}

print "Content-type: text/html\n\n";
$count=0;
if ($form{'action'} eq "subscribe") {
&subscribe;
exit;
}

if ($form{'action'} eq "unsubscribe") {
&unsubscribe;
exit;
}

else {
print "Access Denied";
exit;
}

sub subscribe {
	
unless ($form{'address'}=~/.*\@.*\..*/)   { 
print "message=6"; 
exit;
}

open (list, "<$listdata") or &error("fehler");
if ($flock eq "y") {
flock list, 2; 
}
@list=<list>;
close(list);
	
foreach $list(@list) {
if ($list =~ /$form{'address'}/i) {
print "message=1"; 
exit;
}
}

open (data, ">>$listdata") or &error("fehler");
if ($flock eq "y") {
flock data, 2; 
}
print data "$form{'address'}\n";
close(data);
print "message=2";
exit;	
}

sub unsubscribe {
	
unless ($form{'address'}=~/.*\@.*\..*/)   { 
print "message=6"; 
exit;
}

open (list, "<$listdata") or &error("fehler");
if ($flock eq "y") {
flock list, 2; 
}
@list=<list>;
close(list);
	
foreach $list(@list) {
$count++;
if ($list =~ /$form{'address'}/i) {
$count--;
splice(@list, $count, 1);
open (wlist, ">$listdata") or &error("fehler");
if ($flock eq "y") {
flock wlist, 2; 
}

print wlist @list;
	
close(wlist);
print "message=3";
exit;
}
}
print "message=4";
}

sub error{
print "message=5";
exit;
}
Die .fla
Angehängte Dateien
Dateityp: zip newsletter.zip (35,5 KB, 34x aufgerufen)
Mit Zitat antworten
  #3 (permalink)  
Alt 25-10-2002, 14:03
tobias_k
 Banned
Links : Onlinestatus : tobias_k ist offline
Registriert seit: Aug 2002
Ort: München
Beiträge: 717
tobias_k ist zur Zeit noch ein unbeschriebenes Blatt
Smile wenn...

... du an 'ner kompletten CMS Lösung mit Flash5 & PHP & MySql interresiert bist... also: News anzeigen, erstellen, löschen, bearbeiten pics uploaden.. alles in Flash5 !... (duckmichleichtweilvieleflashhasserhierimforumsind)
melde dich bei mir
Gruß
Mit Zitat antworten
  #4 (permalink)  
Alt 26-10-2002, 12:18
Goaliath
 Newbie
Links : Onlinestatus : Goaliath ist offline
Registriert seit: Oct 2002
Beiträge: 2
Goaliath ist zur Zeit noch ein unbeschriebenes Blatt
Standard danke erstmal

ich habe schon sehr lange nach guten scripten geschaut (auch php, mysql), jedoch das script von www.coder-world.de hat entscheidende vorteile:

- html-newsletter
- persönlicher aktivierungslink (http://www.domain.de/cgi-bin/newslet...I&action=aktiv)
- persönlicher austragungslink
- persönliche bestätigungsmail
- überprüfung auf doppelte, nicht vorhandene, ungültige emailadressen
- versenden von testmails

nachteil ist halt, dass ich von cgi kaum ahnung habe, und leider kein vergleichbares script (bw. in php) bis jetzt gefunden habe.

jetzt habe ich mir überlegt, es gibt auf www.flashworker.de ein newsletterscript in cgi (bei weitem nicht so gut), welches in flash schon eingebettet ist. dieses zu modifizieren ist mir leider nicht gelungen.

vielleicht kennt ihr ein ähnlich gutes script?

gruß,
goaliath
Mit Zitat antworten
  #5 (permalink)  
Alt 26-10-2002, 12:40
tobias_k
 Banned
Links : Onlinestatus : tobias_k ist offline
Registriert seit: Aug 2002
Ort: München
Beiträge: 717
tobias_k ist zur Zeit noch ein unbeschriebenes Blatt
Arrow

Zitat:
- html-newsletter ->(von mir aus bette ich da auch Flash mit sound ein *g*)
- persönlicher aktivierungslink (http://www.domain.de/cgi-bin/newsle...LI&action=aktiv) -> Userverwaltung
- persönlicher austragungslink -> Userverwaltung
- persönliche bestätigungsmail -> eh klar
- überprüfung auf doppelte, nicht vorhandene, ungültige emailadressen -> is sowieso Standart
Wie gesagt, bei Interesse melde dich. Ich mach dir ein CMS System in Flash5... egal für was, nach deinen Bedürfnissen.
Oder such noch'n paar Monate nach open source....
Gruß
Tobias
Mit Zitat antworten
Antwort

Lesezeichen


Aktive Benutzer in diesem Thema: 1 (Registrierte Benutzer: 0, Gäste: 1)
 

Themen-Optionen
Thema bewerten
Thema bewerten:

Forumregeln
Es ist Ihnen nicht erlaubt, neue Themen zu verfassen.
Es ist Ihnen nicht erlaubt, auf Beiträge zu antworten.
Es ist Ihnen nicht erlaubt, Anhänge hochzuladen.
Es ist Ihnen nicht erlaubt, Ihre Beiträge zu bearbeiten.

BB-Code ist an.
Smileys sind an.
[IMG] Code ist an.
HTML-Code ist aus.
Trackbacks are an
Pingbacks are an
Refbacks are an


PHP News

PHP Marktplatz-Software
PHP Marktplatz-SoftwareEs hat sich viel getan! Die neue Version 7.5.9 unserer PHP Marktplatz-Software ebiz-trader steht ab sofort zur Verfügung.

28.10.2019 | Berni

Die RIGID-FLEX-Technologie
Die RIGID-FLEX-TechnologieDie sogenannte "Flexible Elektronik" , oftmals auch als "Flexible Schaltungen" bezeichnet, ist eine zeitgemäße Technologie zum Montieren von elektronischen Schaltungen.

06.12.2018 | Berni


 

Aktuelle PHP Scripte

Microweber CMS

Open source, drag and drop website builder

13.01.2020 Berni | Kategorie: HTML5/ EDITOR
PhoneGap Apps mit JS, CSS3 und HTML5 erstellen ansehen PhoneGap Apps mit JS, CSS3 und HTML5 erstellen

PhoneGap, Framework zur Erstellung hybrider Applikationen für mobile Endgeräte.

13.01.2020 Berni | Kategorie: App-Entwicklung
Bo)Tickets

Bo)Tickets bietet Ihnen eine Schnittstelle für Kundenanfragen an. In dem Script definieren Sie Supportbereiche, also zum Beispiel „Technik, Buchhaltung, Support“. Ihre Kunden können dann über ein Formular eine Anfrage abschicken.

31.12.2019 bocombo | Kategorie: PHP/ Ticketsystem
 Alle PHP Scripte anzeigen

Alle Zeitangaben in WEZ +2. Es ist jetzt 04:13 Uhr.